Igg And Igm Antibodies For Lymes

Human Cardiolipin Antibodies, IgA, IgG and IgM AssayLite Multiplex Fluorescent Immunoassay Kit

FAA3CARL 96 Well Plate
EUR 1472.4

Igg Antibody Laboratories manufactures the igg and igm antibodies for lymes reagents distributed by Genprice. The Igg And Igm Antibodies For Lymes reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: And Group: Igm Antibodies

Human platelet antibodies IgM(PA-IgM)ELISA Kit

1 plate of 24 wells
EUR 198
Description: Qualitativeindirect ELISA kit for measuring Human platelet antibodies IgM (PA-IgM) in samples from serum, plasma. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human platelet antibodies IgM(PA-IgM)ELISA Kit

  • EUR 964.80
  • EUR 6118.80
  • EUR 3244.80
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Qualitativeindirect ELISA kit for measuring Human platelet antibodies IgM(PA-IgM) in samples from serum, plasma. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Serum IgM detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

1 kit
EUR 781.2

Rat Serum IgM detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

1 kit
EUR 781.2

p5 Ligand for Dnak and and DnaJ Peptide

  • EUR 493.20
  • EUR 794.40
  • EUR 376.80
  • 10 mg
  • 25 mg
  • 5 mg

Borrelia 14kD and OspC IgM ELISA Kit

96T
EUR 1048.8
Description: Enzyme immunoassay for measurement of IgM antibodies against the 14 kD and OspC antigens of Borrelia burgdorferi in human serum, plasma and CSF. Infections with all three B. burgdorferi subspecies (garinii, afzelii and senso strictu) are detected.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igm Antibodies information

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Human Anti-Keyhole limpet hemocyanin (KLH) by ELISA

700-140-CUX Custom Ask for price

ELISA kit for Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG)

KTE62929-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG)

KTE62929-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG)

KTE62929-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human anti-Beta2 glycoprotein I antibodies IgG (Beta2-GP1 IgG) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Dengue Virus proteins (DV1-4, Env/prM/NS1) by ELISA

540-100-CUX Custom Ask for price

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Varicella Zoster Virus (VZV/chickenpox) vaccine by ELISA

520-200-CUX Custom Ask for price

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Crimean-Congo hemorrhagic fever virus (CCHFV) by ELISA

AE-320430-CUX Custom Ask for price

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Yellow Fever Virus (YFV) vaccine (ENV/prM/NS1) by ELISA

530-200-CUX Custom Ask for price

Custom Testing of Samples for Antibodies (IgA/IgG/IgM) to Zika Virus (ZIKV) vaccines (Env/NS1/prM/Capsid) by ELISA

RV-403001-CUX Custom Ask for price

Pig Platelet antibodies IgG ELISA kit

E07P0594-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Porcine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Platelet antibodies IgG ELISA kit

E07P0594-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Porcine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Platelet antibodies IgG ELISA kit

E07P0594-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Porcine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Platelet antibodies IgG ELISA kit

E08P0594-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Canine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Platelet antibodies IgG ELISA kit

E08P0594-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Canine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Platelet antibodies IgG ELISA kit

E08P0594-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Canine Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Platelet antibodies IgG ELISA kit

E02P0594-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Rat Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Platelet antibodies IgG ELISA kit

E02P0594-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Rat Platelet antibodies IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.